Lineage for d2hh0h1 (2hh0 H:1-149)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929919Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 929959Domain d2hh0h1: 2hh0 H:1-149 [136462]
    Other proteins in same PDB: d2hh0h2, d2hh0l1, d2hh0l2

Details for d2hh0h1

PDB Entry: 2hh0 (more details), 2.85 Å

PDB Description: structure of an anti-prp fab, p-clone, in complex with its cognate bovine peptide epitope.
PDB Compounds: (H:) Heavy Chain, P-Clone Fab, Chimera

SCOPe Domain Sequences for d2hh0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hh0h1 b.1.1.1 (H:1-149) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
vqlleqsgaelvkpgasvklsctasgfniedsyihwvkqrpeqglewigridpedgetky
apkfqgkatitadtssntaylhlrrltsedtaiyycgrgayyikedfwgqgttltvss

SCOPe Domain Coordinates for d2hh0h1:

Click to download the PDB-style file with coordinates for d2hh0h1.
(The format of our PDB-style files is described here.)

Timeline for d2hh0h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hh0h2