Lineage for d2hgu81 (2hgu 8:1-37)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642131Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
    zinc-bound beta-ribbon motif
  4. 2642132Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
    automatically mapped to Pfam PF00444
  5. 2642133Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 2642134Protein Ribosomal protein L36 [57842] (3 species)
  7. 2642170Species Thermus thermophilus [TaxId:274] [57843] (10 PDB entries)
  8. 2642175Domain d2hgu81: 2hgu 8:1-37 [136461]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgu81

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (8:) 50S ribosomal protein L36

SCOPe Domain Sequences for d2hgu81:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgu81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

SCOPe Domain Coordinates for d2hgu81:

Click to download the PDB-style file with coordinates for d2hgu81.
(The format of our PDB-style files is described here.)

Timeline for d2hgu81: