Class g: Small proteins [56992] (85 folds) |
Fold g.42: Ribosomal protein L36 [57839] (1 superfamily) zinc-bound beta-ribbon motif |
Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) |
Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein) |
Protein Ribosomal protein L36 [57842] (2 species) |
Species Thermus thermophilus [TaxId:274] [57843] (6 PDB entries) |
Domain d2hgu81: 2hgu 8:1-37 [136461] automatically matched to d1dfea_ |
PDB Entry: 2hgu (more details), 4.51 Å
SCOP Domain Sequences for d2hgu81:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgu81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]} mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg
Timeline for d2hgu81: