Lineage for d2hgru1 (2hgr U:16-88)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308916Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 2308917Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 2308918Protein Ribosomal protein S18 [46913] (2 species)
  7. 2308944Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 2308984Domain d2hgru1: 2hgr U:16-88 [136458]
    Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgrv1, d2hgrw1, d2hgrx1
    protein/RNA complex
    protein/RNA complex

Details for d2hgru1

PDB Entry: 2hgr (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.
PDB Compounds: (U:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2hgru1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgru1 a.4.8.1 (U:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d2hgru1:

Click to download the PDB-style file with coordinates for d2hgru1.
(The format of our PDB-style files is described here.)

Timeline for d2hgru1: