![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries) |
![]() | Domain d2hgru1: 2hgr U:16-88 [136458] Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgrv1, d2hgrw1 automatically matched to d1i94r_ |
PDB Entry: 2hgr (more details), 4.51 Å
SCOP Domain Sequences for d2hgru1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgru1 a.4.8.1 (U:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d2hgru1: