Class g: Small proteins [56992] (85 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) |
Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
Protein Ribosomal protein S14 [57753] (1 species) |
Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries) |
Domain d2hgrq1: 2hgr Q:2-61 [136454] Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1 automatically matched to d1fjgn_ |
PDB Entry: 2hgr (more details), 4.51 Å
SCOP Domain Sequences for d2hgrq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgrq1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d2hgrq1: