Lineage for d2hgrp1 (2hgr P:2-126)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348330Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2348331Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2348332Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2348333Protein Ribosomal protein S13 [46948] (2 species)
  7. 2348361Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 2348399Domain d2hgrp1: 2hgr P:2-126 [136453]
    Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1
    protein/RNA complex
    protein/RNA complex

Details for d2hgrp1

PDB Entry: 2hgr (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.
PDB Compounds: (P:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2hgrp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgrp1 a.156.1.1 (P:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOPe Domain Coordinates for d2hgrp1:

Click to download the PDB-style file with coordinates for d2hgrp1.
(The format of our PDB-style files is described here.)

Timeline for d2hgrp1: