![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
![]() | Domain d2hgri1: 2hgr I:1-101 [136447] Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1 protein/RNA complex protein/RNA complex |
PDB Entry: 2hgr (more details), 4.51 Å
SCOPe Domain Sequences for d2hgri1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgri1 d.58.14.1 (I:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2hgri1: