Lineage for d2hgrh2 (2hgr H:5-73)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553728Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2553729Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2553810Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 2553811Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 2553839Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 2553870Domain d2hgrh2: 2hgr H:5-73 [136446]
    Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1
    protein/RNA complex
    protein/RNA complex

Details for d2hgrh2

PDB Entry: 2hgr (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.
PDB Compounds: (H:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2hgrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgrh2 d.50.1.2 (H:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOPe Domain Coordinates for d2hgrh2:

Click to download the PDB-style file with coordinates for d2hgrh2.
(The format of our PDB-style files is described here.)

Timeline for d2hgrh2: