Lineage for d2hgpw1 (2hgp W:8-106)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724538Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 1724539Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1724540Protein Ribosomal protein S20 [46994] (2 species)
  7. 1724568Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 1724606Domain d2hgpw1: 2hgp W:8-106 [136439]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpx1

Details for d2hgpw1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (W:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2hgpw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpw1 a.7.6.1 (W:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2hgpw1:

Click to download the PDB-style file with coordinates for d2hgpw1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpw1: