Lineage for d2hgpw1 (2hgp W:8-106)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636765Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 636766Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 636767Protein Ribosomal protein S20 [46994] (1 species)
  7. 636768Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries)
  8. 636798Domain d2hgpw1: 2hgp W:8-106 [136439]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1
    automatically matched to d1i94t_

Details for d2hgpw1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (W:) 30S ribosomal protein S20

SCOP Domain Sequences for d2hgpw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpw1 a.7.6.1 (W:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d2hgpw1:

Click to download the PDB-style file with coordinates for d2hgpw1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpw1: