Lineage for d2hgpv1 (2hgp V:2-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942145Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2942146Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2942147Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2942148Protein Ribosomal protein S19 [54572] (2 species)
  7. 2942176Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 2942207Domain d2hgpv1: 2hgp V:2-81 [136438]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpw1, d2hgpx1

Details for d2hgpv1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (V:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2hgpv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpv1 d.28.1.1 (V:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2hgpv1:

Click to download the PDB-style file with coordinates for d2hgpv1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpv1: