Lineage for d2hgpt1 (2hgp T:2-105)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314898Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1315222Protein Ribosomal protein S17 [50304] (3 species)
  7. 1315252Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 1315289Domain d2hgpt1: 2hgp T:2-105 [136436]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1
    automatically matched to d1fjgq_

Details for d2hgpt1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (T:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2hgpt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpt1 b.40.4.5 (T:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOPe Domain Coordinates for d2hgpt1:

Click to download the PDB-style file with coordinates for d2hgpt1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpt1: