Class g: Small proteins [56992] (90 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
Protein Ribosomal protein S14 [57753] (2 species) |
Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries) Uniprot P24320 |
Domain d2hgpq1: 2hgp Q:2-61 [136433] Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1 automatically matched to d1fjgn_ |
PDB Entry: 2hgp (more details), 5.5 Å
SCOPe Domain Sequences for d2hgpq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgpq1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d2hgpq1: