Lineage for d2hgpq1 (2hgp Q:2-61)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463710Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1463711Protein Ribosomal protein S14 [57753] (2 species)
  7. 1463737Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1463774Domain d2hgpq1: 2hgp Q:2-61 [136433]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1
    automatically matched to d1fjgn_

Details for d2hgpq1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (Q:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2hgpq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpq1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2hgpq1:

Click to download the PDB-style file with coordinates for d2hgpq1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpq1: