Lineage for d2hgpm1 (2hgp M:3-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725134Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 725135Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 725136Protein Ribosomal protein S10 [55001] (1 species)
  7. 725137Species Thermus thermophilus [TaxId:274] [55002] (36 PDB entries)
  8. 725167Domain d2hgpm1: 2hgp M:3-100 [136429]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1
    automatically matched to d1fjgj_

Details for d2hgpm1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (M:) 30S ribosomal protein S10

SCOP Domain Sequences for d2hgpm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpm1 d.58.15.1 (M:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d2hgpm1:

Click to download the PDB-style file with coordinates for d2hgpm1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpm1: