Lineage for d2hgpj1 (2hgp J:2-156)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274376Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1274377Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1274378Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1274379Protein Ribosomal protein S7 [47975] (4 species)
  7. 1274409Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1274447Domain d2hgpj1: 2hgp J:2-156 [136427]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1
    automatically matched to d1fjgg_

Details for d2hgpj1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (J:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2hgpj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpj1 a.75.1.1 (J:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2hgpj1:

Click to download the PDB-style file with coordinates for d2hgpj1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpj1: