![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
![]() | Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
![]() | Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
![]() | Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
![]() | Domain d2hgph2: 2hgp H:5-73 [136425] Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1 automatically matched to d1i94e2 |
PDB Entry: 2hgp (more details), 5.5 Å
SCOPe Domain Sequences for d2hgph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgph2 d.50.1.2 (H:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d2hgph2: