Lineage for d2hgpg1 (2hgp G:2-209)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726401Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 726402Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 726403Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 726404Protein Ribosomal protein S4 [55179] (2 species)
    also contains a Zn-binding N-terminal subdomain
  7. 726408Species Thermus thermophilus [TaxId:274] [55180] (36 PDB entries)
  8. 726438Domain d2hgpg1: 2hgp G:2-209 [136423]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpk1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1
    automatically matched to d1hnwd_

Details for d2hgpg1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (G:) 30S ribosomal protein S4

SCOP Domain Sequences for d2hgpg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpg1 d.66.1.2 (G:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d2hgpg1:

Click to download the PDB-style file with coordinates for d2hgpg1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpg1: