Class g: Small proteins [56992] (90 folds) |
Fold g.42: Ribosomal protein L36 [57839] (1 superfamily) zinc-bound beta-ribbon motif |
Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) |
Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein) |
Protein Ribosomal protein L36 [57842] (3 species) |
Species Thermus thermophilus [TaxId:274] [57843] (6 PDB entries) |
Domain d2hgj81: 2hgj 8:1-37 [136419] Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 automatically matched to d1dfea_ |
PDB Entry: 2hgj (more details), 5 Å
SCOPe Domain Sequences for d2hgj81:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgj81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]} mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg
Timeline for d2hgj81:
View in 3D Domains from other chains: (mouse over for more information) d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |