SCOP 1.73: Domain d2hgj81: 2hgj 8:1-37

Lineage for d2hgj81 (2hgj 8:1-37)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
   zinc-bound beta-ribbon motif

4. Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family)

5. Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)

6. Protein Ribosomal protein L36 [57842] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57843] (6 PDB entries)

8. Domain d2hgj81: 2hgj 8:1-37 [136419]
   automatically matched to d1dfea_

Details for d2hgj81

PDB Entry: 2hgj, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.

PDB Compounds: (8:) 50S ribosomal protein L36

SCOP Domain Sequences for d2hgj81:

Sequence; same for both SEQRES and ATOM records:

>d2hgj81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

Timeline for d2hgj81:

• d2hgj81 is new in SCOP 1.73
  
• d2hgj81 appears in SCOP 1.75
  
• d2hgj81 appears in the current release, SCOPe 2.08