Lineage for d2hgj81 (2hgj 8:1-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037437Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
    zinc-bound beta-ribbon motif
  4. 3037438Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
    automatically mapped to Pfam PF00444
  5. 3037439Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 3037440Protein Ribosomal protein L36 [57842] (3 species)
  7. 3037476Species Thermus thermophilus [TaxId:274] [57843] (10 PDB entries)
  8. 3037480Domain d2hgj81: 2hgj 8:1-37 [136419]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgj81

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (8:) 50S ribosomal protein L36

SCOPe Domain Sequences for d2hgj81:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgj81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

SCOPe Domain Coordinates for d2hgj81:

Click to download the PDB-style file with coordinates for d2hgj81.
(The format of our PDB-style files is described here.)

Timeline for d2hgj81: