Lineage for d2hgiw1 (2hgi W:8-106)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636765Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 636766Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 636767Protein Ribosomal protein S20 [46994] (1 species)
  7. 636768Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries)
  8. 636797Domain d2hgiw1: 2hgi W:8-106 [136418]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1
    automatically matched to d1i94t_

Details for d2hgiw1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (W:) 30S ribosomal protein S20

SCOP Domain Sequences for d2hgiw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgiw1 a.7.6.1 (W:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d2hgiw1:

Click to download the PDB-style file with coordinates for d2hgiw1.
(The format of our PDB-style files is described here.)

Timeline for d2hgiw1: