Lineage for d2hgir1 (2hgi R:2-89)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986937Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1986938Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 1986984Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 1986985Protein Ribosomal protein S15 [47065] (3 species)
  7. 1986999Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 1987034Domain d2hgir1: 2hgi R:2-89 [136413]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1

Details for d2hgir1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (R:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2hgir1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgir1 a.16.1.2 (R:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2hgir1:

Click to download the PDB-style file with coordinates for d2hgir1.
(The format of our PDB-style files is described here.)

Timeline for d2hgir1: