Lineage for d2hgio1 (2hgi O:5-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789950Protein Ribosomal protein S12 [50302] (2 species)
  7. 2789977Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
    Uniprot P17293
  8. 2790007Domain d2hgio1: 2hgi O:5-122 [136410]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1

Details for d2hgio1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (O:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2hgio1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgio1 b.40.4.5 (O:5-122) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygt

SCOPe Domain Coordinates for d2hgio1:

Click to download the PDB-style file with coordinates for d2hgio1.
(The format of our PDB-style files is described here.)

Timeline for d2hgio1: