Lineage for d2hgii1 (2hgi I:1-101)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196631Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2196632Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2196633Protein Ribosomal protein S6 [54997] (4 species)
  7. 2196663Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2196707Domain d2hgii1: 2hgi I:1-101 [136405]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1

Details for d2hgii1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (I:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2hgii1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgii1 d.58.14.1 (I:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2hgii1:

Click to download the PDB-style file with coordinates for d2hgii1.
(The format of our PDB-style files is described here.)

Timeline for d2hgii1: