![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) automatically mapped to Pfam PF00333 |
![]() | Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
![]() | Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
![]() | Domain d2hgih2: 2hgi H:5-73 [136404] Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1 |
PDB Entry: 2hgi (more details), 5 Å
SCOPe Domain Sequences for d2hgih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgih2 d.50.1.2 (H:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d2hgih2: