SCOP 1.73: Domain d2hgih1: 2hgi H:74-154

Lineage for d2hgih1 (2hgi H:74-154)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)

8. Domain d2hgih1: 2hgi H:74-154 [136403]
   Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1
   automatically matched to d1i94e1

Details for d2hgih1

PDB Entry: 2hgi, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.

PDB Compounds: (H:) 30S ribosomal protein S5

SCOP Domain Sequences for d2hgih1:

Sequence; same for both SEQRES and ATOM records:

>d2hgih1 d.14.1.1 (H:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2hgih1:

• d2hgih1 is new in SCOP 1.73
  
• d2hgih1 appears in SCOP 1.75
  
• d2hgih1 appears in the current release, SCOPe 2.08