Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries) |
Domain d2hgig1: 2hgi G:2-209 [136402] Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1 automatically matched to d1hnwd_ |
PDB Entry: 2hgi (more details), 5 Å
SCOP Domain Sequences for d2hgig1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgig1 d.66.1.2 (G:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm kgkflrlpdredlalpvneqlviefysr
Timeline for d2hgig1: