![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins) L and M are probably related to each other |
![]() | Protein M (medium) subunit [81481] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries) Uniprot P02953 |
![]() | Domain d2hg9m1: 2hg9 M:1-302 [136395] Other proteins in same PDB: d2hg9l1 automatically matched to d2rcrm_ complexed with bcl, bph, cdl, cl, fe, gol, k, lda, pc7, pck, po4, u10 |
PDB Entry: 2hg9 (more details), 2.45 Å
SCOP Domain Sequences for d2hg9m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg9m1 f.26.1.1 (M:1-302) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg
Timeline for d2hg9m1: