SCOPe 2.05: Domain d2hg5d1: 2hg5 D:86-119

Lineage for d2hg5d1 (2hg5 D:86-119)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (17 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d2hg5d1: 2hg5 D:86-119 [136393]
   automatically matched to d1jq1a_
   complexed with b3h, cs, goa

Details for d2hg5d1

PDB Entry: 2hg5, 2.75 Å

PDB Description: cs+ complex of a k channel with an amide to ester substitution in the selectivity filter

PDB Compounds: (D:) KcsA Channel

SCOPe Domain Sequences for d2hg5d1:

Sequence; same for both SEQRES and ATOM records:

>d2hg5d1 f.14.1.1 (D:86-119) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lwgrlvavvvmvagitsfglvtaalatwfvgreq

Timeline for d2hg5d1:

• d2hg5d1 first appeared in SCOP 1.73
  
• d2hg5d1 appears in SCOPe 2.04
  
• d2hg5d1 appears in SCOPe 2.06
  
• d2hg5d1 appears in the current release, SCOPe 2.08