Lineage for d2hg3m1 (2hg3 M:1-302)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746204Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 746205Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 746206Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 746280Protein M (medium) subunit [81481] (3 species)
  7. 746281Species Rhodobacter sphaeroides [TaxId:1063] [81479] (50 PDB entries)
  8. 746301Domain d2hg3m1: 2hg3 M:1-302 [136392]
    Other proteins in same PDB: d2hg3l1
    automatically matched to d2rcrm_
    complexed with bcl, bph, cdl, fe, gol, hto, k, lda, pc9, po4, u10

Details for d2hg3m1

PDB Entry: 2hg3 (more details), 2.7 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with brominated phosphatidylcholine
PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d2hg3m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg3m1 f.26.1.1 (M:1-302) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOP Domain Coordinates for d2hg3m1:

Click to download the PDB-style file with coordinates for d2hg3m1.
(The format of our PDB-style files is described here.)

Timeline for d2hg3m1: