Lineage for d2hfgh1 (2hfg H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652445Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (51 PDB entries)
  8. 652472Domain d2hfgh1: 2hfg H:1-113 [136383]
    Other proteins in same PDB: d2hfgh2
    automatically matched to d1mf2h1
    mutant

Details for d2hfgh1

PDB Entry: 2hfg (more details), 2.61 Å

PDB Description: crystal structure of hbr3 bound to cb3s-fab
PDB Compounds: (H:) CB3s Fab heavy chain

SCOP Domain Sequences for d2hfgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggglvqpggslrlscaasgftissssihwvrqapgkglewvawvlpsvgftdy
adsvkgrftisadtskntaylqmnslraedtavyycarrvcynrlgvcaggmdywgqgtl
vtvss

SCOP Domain Coordinates for d2hfgh1:

Click to download the PDB-style file with coordinates for d2hfgh1.
(The format of our PDB-style files is described here.)

Timeline for d2hfgh1: