Lineage for d2hffh1 (2hff H:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740091Domain d2hffh1: 2hff H:1-113 [136381]
    Other proteins in same PDB: d2hffa1, d2hffa2, d2hffb2, d2hffh2, d2hffl1, d2hffl2
    automatically matched to d1mf2h1

Details for d2hffh1

PDB Entry: 2hff (more details), 1.95 Å

PDB Description: Crystal structure of CB2 Fab
PDB Compounds: (H:) CB2 Fab, heavy chain

SCOPe Domain Sequences for d2hffh1:

Sequence, based on SEQRES records: (download)

>d2hffh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
adsvkgrftisadtskntaylqmnslraedtavyycarrvcynrlgvcaggmdywgqgtl
vtvss

Sequence, based on observed residues (ATOM records): (download)

>d2hffh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggglvqpggslrlscaasgftissnsihwvrqapgkglewvawitpsdgntdy
adsvkgrftisadtskntaylqmnslraedtavyycarrvcaggmdywgqgtlvtvss

SCOPe Domain Coordinates for d2hffh1:

Click to download the PDB-style file with coordinates for d2hffh1.
(The format of our PDB-style files is described here.)

Timeline for d2hffh1: