Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.20: HyaE-like [142401] (2 proteins) Pfam PF07449; have evolved a different function; contains no conserved cysteine residues |
Protein Hydrogenase-1 operon protein HyaE [142402] (3 species) |
Species Escherichia coli [TaxId:562] [142403] (1 PDB entry) Uniprot P19931 1-132 |
Domain d2hfda1: 2hfd A:1-132 [136377] |
PDB Entry: 2hfd (more details)
SCOPe Domain Sequences for d2hfda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm rglvepqqeras
Timeline for d2hfda1: