Lineage for d2hfda1 (2hfd A:1-132)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878879Family c.47.1.20: HyaE-like [142401] (2 proteins)
    Pfam PF07449; have evolved a different function; contains no conserved cysteine residues
  6. 2878880Protein Hydrogenase-1 operon protein HyaE [142402] (3 species)
  7. 2878881Species Escherichia coli [TaxId:562] [142403] (1 PDB entry)
    Uniprot P19931 1-132
  8. 2878882Domain d2hfda1: 2hfd A:1-132 [136377]

Details for d2hfda1

PDB Entry: 2hfd (more details)

PDB Description: nmr structure of protein hydrogenase-1 operon protein hyae from escherichia coli: northeast structural genomics consortium target er415
PDB Compounds: (A:) Hydrogenase-1 operon protein hyaE

SCOPe Domain Sequences for d2hfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]}
msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm
rglvepqqeras

SCOPe Domain Coordinates for d2hfda1:

Click to download the PDB-style file with coordinates for d2hfda1.
(The format of our PDB-style files is described here.)

Timeline for d2hfda1: