Lineage for d2heyt1 (2hey T:83-142)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639462Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor [144119] (1 species)
  7. 2639463Species Human (Homo sapiens) [TaxId:9606] [144120] (3 PDB entries)
    Uniprot P43489 143-168! Uniprot P43489 29-82! Uniprot P43489 83-142
  8. 2639467Domain d2heyt1: 2hey T:83-142 [136370]
    Other proteins in same PDB: d2heyf_, d2heyg_
    automated match to d2hevr1
    complexed with so4

Details for d2heyt1

PDB Entry: 2hey (more details), 2 Å

PDB Description: Crystal structure of murine OX40L bound to human OX40
PDB Compounds: (T:) Tumor necrosis factor receptor superfamily member 4

SCOPe Domain Sequences for d2heyt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heyt1 g.24.1.1 (T:83-142) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]}
pctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqack

SCOPe Domain Coordinates for d2heyt1:

Click to download the PDB-style file with coordinates for d2heyt1.
(The format of our PDB-style files is described here.)

Timeline for d2heyt1: