Lineage for d2heyt1 (2hey T:83-142)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749631Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 749632Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 749633Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 749712Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor [144119] (1 species)
  7. 749713Species Human (Homo sapiens) [TaxId:9606] [144120] (2 PDB entries)
  8. 749717Domain d2heyt1: 2hey T:83-142 [136370]
    Other proteins in same PDB: d2heyf1, d2heyg1
    automatically matched to 2HEV R:83-142
    complexed with so4

Details for d2heyt1

PDB Entry: 2hey (more details), 2 Å

PDB Description: Crystal structure of murine OX40L bound to human OX40
PDB Compounds: (T:) Tumor necrosis factor receptor superfamily member 4

SCOP Domain Sequences for d2heyt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heyt1 g.24.1.1 (T:83-142) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]}
pctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqack

SCOP Domain Coordinates for d2heyt1:

Click to download the PDB-style file with coordinates for d2heyt1.
(The format of our PDB-style files is described here.)

Timeline for d2heyt1: