Lineage for d2heyr3 (2hey R:29-82)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064701Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1064702Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 1064703Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 1064790Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor [144119] (1 species)
  7. 1064791Species Human (Homo sapiens) [TaxId:9606] [144120] (2 PDB entries)
    Uniprot P43489 143-168! Uniprot P43489 29-82! Uniprot P43489 83-142
  8. 1064794Domain d2heyr3: 2hey R:29-82 [136369]
    Other proteins in same PDB: d2heyf_, d2heyg_
    automatically matched to 2HEV R:29-82
    complexed with so4

Details for d2heyr3

PDB Entry: 2hey (more details), 2 Å

PDB Description: Crystal structure of murine OX40L bound to human OX40
PDB Compounds: (R:) Tumor necrosis factor receptor superfamily member 4

SCOPe Domain Sequences for d2heyr3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heyr3 g.24.1.1 (R:29-82) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]}
lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpck

SCOPe Domain Coordinates for d2heyr3:

Click to download the PDB-style file with coordinates for d2heyr3.
(The format of our PDB-style files is described here.)

Timeline for d2heyr3: