![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (2 families) ![]() |
![]() | Family g.24.1.1: TNF receptor-like [57587] (5 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
![]() | Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor [144119] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144120] (2 PDB entries) Uniprot P43489 143-168! Uniprot P43489 29-82! Uniprot P43489 83-142 |
![]() | Domain d2heyr1: 2hey R:83-142 [136367] Other proteins in same PDB: d2heyf1, d2heyg1 automatically matched to 2HEV R:83-142 complexed with so4 |
PDB Entry: 2hey (more details), 2 Å
SCOP Domain Sequences for d2heyr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2heyr1 g.24.1.1 (R:83-142) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]} pctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqack
Timeline for d2heyr1: