![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (1 family) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (14 proteins) |
![]() | Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141129] (2 PDB entries) Uniprot P43488 58-185 |
![]() | Domain d2heyg1: 2hey G:58-185 [136366] Other proteins in same PDB: d2heyr1, d2heyr2, d2heyr3, d2heyt1, d2heyt2, d2heyt3 automatically matched to 2HEW F:58-185 complexed with so4 |
PDB Entry: 2hey (more details), 2 Å
SCOP Domain Sequences for d2heyg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2heyg1 b.22.1.1 (G:58-185) Tumor necrosis factor ligand superfamily member 4, OX40L {Mouse (Mus musculus) [TaxId: 10090]} ppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevkid lhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivvq ltpgycap
Timeline for d2heyg1: