Lineage for d2heyf1 (2hey F:58-185)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662724Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662725Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 662726Family b.22.1.1: TNF-like [49843] (13 proteins)
  6. 662898Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species)
  7. 662901Species Mouse (Mus musculus) [TaxId:10090] [141129] (2 PDB entries)
  8. 662903Domain d2heyf1: 2hey F:58-185 [136365]
    Other proteins in same PDB: d2heyr1, d2heyr2, d2heyr3, d2heyt1, d2heyt2, d2heyt3
    automatically matched to 2HEW F:58-185
    complexed with so4

Details for d2heyf1

PDB Entry: 2hey (more details), 2 Å

PDB Description: Crystal structure of murine OX40L bound to human OX40
PDB Compounds: (F:) Tumor necrosis factor ligand superfamily member 4

SCOP Domain Sequences for d2heyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heyf1 b.22.1.1 (F:58-185) Tumor necrosis factor ligand superfamily member 4, OX40L {Mouse (Mus musculus) [TaxId: 10090]}
ppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevkid
lhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivvq
ltpgycap

SCOP Domain Coordinates for d2heyf1:

Click to download the PDB-style file with coordinates for d2heyf1.
(The format of our PDB-style files is described here.)

Timeline for d2heyf1: