Lineage for d2hevr3 (2hev R:29-82)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064701Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1064702Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 1064703Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 1064790Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor [144119] (1 species)
  7. 1064791Species Human (Homo sapiens) [TaxId:9606] [144120] (2 PDB entries)
    Uniprot P43489 143-168! Uniprot P43489 29-82! Uniprot P43489 83-142
  8. 1064800Domain d2hevr3: 2hev R:29-82 [136363]
    Other proteins in same PDB: d2hevf1
    complexed with nag

Details for d2hevr3

PDB Entry: 2hev (more details), 2.41 Å

PDB Description: crystal structure of the complex between ox40l and ox40
PDB Compounds: (R:) Tumor necrosis factor receptor superfamily member 4

SCOPe Domain Sequences for d2hevr3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hevr3 g.24.1.1 (R:29-82) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]}
lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpck

SCOPe Domain Coordinates for d2hevr3:

Click to download the PDB-style file with coordinates for d2hevr3.
(The format of our PDB-style files is described here.)

Timeline for d2hevr3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hevf1