SCOPe 2.02: Domain d2hevf1: 2hev F:58-183

Lineage for d2hevf1 (2hev F:58-183)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141128] (1 PDB entry)
   Uniprot P23510 58-183

8. Domain d2hevf1: 2hev F:58-183 [136360]
   Other proteins in same PDB: d2hevr1, d2hevr2, d2hevr3
   complexed with nag

Details for d2hevf1

PDB Entry: 2hev, 2.41 Å

PDB Description: crystal structure of the complex between ox40l and ox40

PDB Compounds: (F:) Tumor necrosis factor ligand superfamily member 4

SCOPe Domain Sequences for d2hevf1:

Sequence; same for both SEQRES and ATOM records:

>d2hevf1 b.22.1.1 (F:58-183) Tumor necrosis factor ligand superfamily member 4, OX40L {Human (Homo sapiens) [TaxId: 9606]}
riqsikvqfteykkekgfiltsqkedeimkvqdnsviincdgfylislkgyfsqevdisl
hyqkdeeplfqlkkvrsvnslmvasltykdkvylnvttdntslddfhvnggelilihqnp
gefcvl

Timeline for d2hevf1:

• d2hevf1 first appeared in SCOP 1.73
  
• d2hevf1 appears in SCOPe 2.01
  
• d2hevf1 appears in SCOPe 2.03
  
• d2hevf1 appears in the current release, SCOPe 2.08