Lineage for d2hevf1 (2hev F:58-183)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793598Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 793599Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 793600Family b.22.1.1: TNF-like [49843] (14 proteins)
  6. 793803Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species)
  7. 793804Species Human (Homo sapiens) [TaxId:9606] [141128] (1 PDB entry)
    Uniprot P23510 58-183
  8. 793805Domain d2hevf1: 2hev F:58-183 [136360]
    Other proteins in same PDB: d2hevr1, d2hevr2, d2hevr3
    complexed with nag; mutant

Details for d2hevf1

PDB Entry: 2hev (more details), 2.41 Å

PDB Description: crystal structure of the complex between ox40l and ox40
PDB Compounds: (F:) Tumor necrosis factor ligand superfamily member 4

SCOP Domain Sequences for d2hevf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hevf1 b.22.1.1 (F:58-183) Tumor necrosis factor ligand superfamily member 4, OX40L {Human (Homo sapiens) [TaxId: 9606]}
riqsikvqfteykkekgfiltsqkedeimkvqdnsviincdgfylislkgyfsqevdisl
hyqkdeeplfqlkkvrsvnslmvasltykdkvylnvttdntslddfhvnggelilihqnp
gefcvl

SCOP Domain Coordinates for d2hevf1:

Click to download the PDB-style file with coordinates for d2hevf1.
(The format of our PDB-style files is described here.)

Timeline for d2hevf1: