SCOP 1.73: Domain d2hevf1: 2hev F:58-183

Lineage for d2hevf1 (2hev F:58-183)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (1 family)

5. Family b.22.1.1: TNF-like [49843] (13 proteins)

6. Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141128] (1 PDB entry)

8. Domain d2hevf1: 2hev F:58-183 [136360]
   Other proteins in same PDB: d2hevr1, d2hevr2, d2hevr3
   complexed with nag; mutant

Details for d2hevf1

PDB Entry: 2hev, 2.41 Å

PDB Description: crystal structure of the complex between ox40l and ox40

PDB Compounds: (F:) Tumor necrosis factor ligand superfamily member 4

SCOP Domain Sequences for d2hevf1:

Sequence; same for both SEQRES and ATOM records:

>d2hevf1 b.22.1.1 (F:58-183) Tumor necrosis factor ligand superfamily member 4, OX40L {Human (Homo sapiens) [TaxId: 9606]}
riqsikvqfteykkekgfiltsqkedeimkvqdnsviincdgfylislkgyfsqevdisl
hyqkdeeplfqlkkvrsvnslmvasltykdkvylnvttdntslddfhvnggelilihqnp
gefcvl

Timeline for d2hevf1:

• d2hevf1 is new in SCOP 1.73
  
• d2hevf1 appears in SCOP 1.75
  
• d2hevf1 appears in the current release, SCOPe 2.08