SCOPe 2.08: Domain d2hetd_: 2het D:

Lineage for d2hetd_ (2het D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Recoverin [47533] (1 species)
   Calcium-myristoyl switch; only one EF-hand is functional

7. Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)

8. Domain d2hetd_: 2het D: [136359]
   automated match to d2d8na_
   complexed with ca
   has additional insertions and/or extensions that are not grouped together

Details for d2hetd_

PDB Entry: 2het, 3 Å

PDB Description: Non-myristoylated bovine recoverin (truncated at C-terminus) with calcium bound to EF-hand 3

PDB Compounds: (D:) Recoverin

SCOPe Domain Sequences for d2hetd_:

Sequence; same for both SEQRES and ATOM records:

>d2hetd_ a.39.1.5 (D:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
ep

Timeline for d2hetd_:

• d2hetd_ first appeared in SCOP 1.73, called d2hetd1
  
• d2hetd_ appears in SCOPe 2.07