Lineage for d2hetb1 (2het B:9-190)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 769046Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 769047Species Cow (Bos taurus) [TaxId:9913] [47534] (8 PDB entries)
  8. 769052Domain d2hetb1: 2het B:9-190 [136357]
    automatically matched to d1omra_
    complexed with ca

Details for d2hetb1

PDB Entry: 2het (more details), 3 Å

PDB Description: Non-myristoylated bovine recoverin (truncated at C-terminus) with calcium bound to EF-hand 3
PDB Compounds: (B:) Recoverin

SCOP Domain Sequences for d2hetb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hetb1 a.39.1.5 (B:9-190) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
ep

SCOP Domain Coordinates for d2hetb1:

Click to download the PDB-style file with coordinates for d2hetb1.
(The format of our PDB-style files is described here.)

Timeline for d2hetb1: