Lineage for d2hekb_ (2hek B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342125Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2342201Protein automated matches [190349] (3 species)
    not a true protein
  7. 2342202Species Aquifex aeolicus [TaxId:63363] [187322] (1 PDB entry)
  8. 2342203Domain d2hekb_: 2hek B: [136355]
    Other proteins in same PDB: d2heka1
    automated match to d2heka1
    complexed with br, cl, gdp, gol, po4, zn

Details for d2hekb_

PDB Entry: 2hek (more details), 2 Å

PDB Description: crystal structure of o67745, a hypothetical protein from aquifex aeolicus at 2.0 a resolution.
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2hekb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hekb_ a.211.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mikefsdplygfvrvgeaglrlidsfpfqrlryvkqlglaylvfpsaqhtrfehslgvyh
itericeslkvkekelvklagllhdlghppfshttevllprershedfterviketeiye
ilkqdyshedierlvritlgkpedeeekllseiitgefgsdrmdylrrdayfcgvsygff
dydrlistlrvyenkvvvdesglralenflisryfmyvqvyfhkvvrilsihlveflkkl
isqedftdinnflrlndafviselfkrkafredferifqrkhfktllstenyekfsetke
rllekfpqekvrfdevekevyggniyvlsseglkkahelspliaslkpiklyriyvdrql
wekarselk

SCOPe Domain Coordinates for d2hekb_:

Click to download the PDB-style file with coordinates for d2hekb_.
(The format of our PDB-style files is described here.)

Timeline for d2hekb_: