Lineage for d2hdqa1 (2hdq A:4-361)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742174Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)
  6. 742175Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 742193Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (39 PDB entries)
  8. 742244Domain d2hdqa1: 2hdq A:4-361 [136346]
    automatically matched to d1c3ba_
    complexed with c21

Details for d2hdqa1

PDB Entry: 2hdq (more details), 2.1 Å

PDB Description: AmpC beta-lactamase in complex with 2-carboxythiophene
PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d2hdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdqa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d2hdqa1:

Click to download the PDB-style file with coordinates for d2hdqa1.
(The format of our PDB-style files is described here.)

Timeline for d2hdqa1: