Lineage for d2hdoa1 (2hdo A:1-207)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712302Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (9 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 712333Protein Phosphoglycolate phosphatase [142135] (1 species)
  7. 712334Species Lactobacillus plantarum [TaxId:1590] [142136] (1 PDB entry)
  8. 712335Domain d2hdoa1: 2hdo A:1-207 [136345]
    complexed with po4

Details for d2hdoa1

PDB Entry: 2hdo (more details), 1.5 Å

PDB Description: crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution
PDB Compounds: (A:) Phosphoglycolate phosphatase

SCOP Domain Sequences for d2hdoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]}
mtyqalmfdidgtltnsqpayttvmrevlatygkpfspaqaqktfpmaaeqamtelgiaa
sefdhfqaqyedvmashydqielypgitslfeqlpselrlgivtsqrrnelesgmrsypf
mmrmavtisaddtpkrkpdplplltalekvnvapqnalfigdsvsdeqtaqaanvdfgla
vwgmdpnadhqkvahrfqkpldilelf

SCOP Domain Coordinates for d2hdoa1:

Click to download the PDB-style file with coordinates for d2hdoa1.
(The format of our PDB-style files is described here.)

Timeline for d2hdoa1: