Lineage for d2hdjb1 (2hdj B:2-323)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681974Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 681975Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 681995Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 681996Species Human (Homo sapiens), type III [TaxId:9606] [69383] (4 PDB entries)
    bile acid binding protein
  8. 682002Domain d2hdjb1: 2hdj B:2-323 [136344]
    automatically matched to d1j96a_
    complexed with edo, ndp, so4

Details for d2hdjb1

PDB Entry: 2hdj (more details), 2 Å

PDB Description: Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with NADP(H)
PDB Compounds: (B:) Aldo-keto reductase family 1 member C2

SCOP Domain Sequences for d2hdjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdjb1 c.1.7.1 (B:2-323) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
nvryltldifagppnypfsdey

SCOP Domain Coordinates for d2hdjb1:

Click to download the PDB-style file with coordinates for d2hdjb1.
(The format of our PDB-style files is described here.)

Timeline for d2hdjb1: